Skip to main content

Advertisement

Table 2 The junction region of matrilins contains potential proteolytic cleavage sites.

From: Multiple functions of the von Willebrand Factor A domain in matrilins: secretion, assembly, and proteolysis

Matrilin Species Amino Acid Sequence Number (a.a.)
MATN1 Human EE DP 4
  Mouse EE DP 4
  Chicken EE DP 4
MATN2 Human KLKKGICEALEDSDGRQDSPAGELPKTVQQPT ESEPVTINIQDLLSCSNFAVQHRYLFEE DNLL RSTQKLSHSTKPSGSPLEE 83
  Mouse KLKEGICEALEDSGGRQDSAAWDLPQQAHQP TEPEPVTIKIKDLLSCSNFAVQHRFLFEE DN LSRSTQKLFHSTKSSGNPLEE 83
  Chicken ELKVQICEALRNSAHQQHLSSGRLHRTNPQPSGPESTTVEITDVLACPSLAIQHKYLFEDSQSHSTRTTAKT 72
MATN3 Human ATEE ARRLVSTEDA 14
  Mouse DIEE ARSLISIEDA 14
  Chicken RATTSSLVTDEE A 13
MATN4 Human PEE GISAGTELRSP 14
  Mouse PEE GIGAGTELRSP 14
  Chicken PEE GRGETEIRSP 13
  1. A pair of glutamic residues as the putative matrix cleavage site is underlined and is present in all the members of matrilin family across species with the only exception of chicken MATN2. a.a.: amino acid.